Kaptin (KPTN) (NM_007059) Human Recombinant Protein

Kaptin protein,

Recombinant protein of human kaptin (actin binding protein) (KPTN)

Product Info Summary

SKU: PROTQ9Y664
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Kaptin (KPTN) (NM_007059) Human Recombinant Protein

View all Kaptin recombinant proteins

SKU/Catalog Number

PROTQ9Y664

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kaptin (actin binding protein) (KPTN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Kaptin (KPTN) (NM_007059) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y664)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.9 kDa

Amino Acid Sequence

MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS

Validation Images & Assay Conditions

Gene/Protein Information For KPTN (Source: Uniprot.org, NCBI)

Gene Name

KPTN

Full Name

KICSTOR complex protein kaptin

Weight

47.9 kDa

Alternative Names

2E4; Actin-associated protein 2E4; kaptin (actin binding protein); kaptin (actin-binding protein); kaptin KPTN 2E4, KICS4, MRT41 kaptin, actin binding protein KICSTOR complex protein kaptin|actin-associated protein 2E4|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KPTN, check out the KPTN Infographic

KPTN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KPTN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y664

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Kaptin (KPTN) (NM_007059) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Kaptin (KPTN) (NM_007059) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Kaptin (KPTN) (NM_007059) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y664
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.