Click image to see more details
Product Info Summary
| SKU: | A00758-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SOX10 Antibody Picoband®
SKU/Catalog Number
A00758-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SOX10 Antibody Picoband® catalog # A00758-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SOX10 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00758-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SOX10, which shares 97.1% amino acid (aa) sequence identity with both mouse and rat SOX10.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00758-1 is reactive to SOX10 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
60 kDa
Calculated molecular weight
49,911MW
Background of SOX10
Transcription factor SOX-10 is a protein that in humans is encoded by the SOX10 gene. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00758-1 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry, 2-5μg/ml
Positive Control
WB: human SH-SY5Y whole cell, human U251 whole cell, human U2OS whole cell, human U87 whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, mouse Neuro-2a whole cellIHC: human melanoma tissue, mouse brain tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SOX10 using anti-SOX10 antibody (A00758-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human SH-SY5Y whole cell lysates,
Lane 2: human U251 whole cell lysates,
Lane 3: human U2OS whole cell lysates,
Lane 4: human U87 whole cell lysates,
Lane 5: rat brain tissue lysates,
Lane 6: rat C6 whole cell lysates,
Lane 7: mouse brain tissue lysates,
Lane 8: mouse Neuro-2a whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX10 antigen affinity purified polyclonal antibody (Catalog # A00758-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SOX10 at approximately 60 kDa. The expected band size for SOX10 is at 50 kDa.
Click image to see more details
Figure 2. IHC analysis of SOX10 using anti-SOX10 antibody (A00758-1).
SOX10 was detected in a paraffin-embedded section of human melanoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-SOX10 Antibody (A00758-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of SOX10 using anti-SOX10 antibody (A00758-1).
SOX10 was detected in a paraffin-embedded section of human melanoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-SOX10 Antibody (A00758-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of SOX10 using anti-SOX10 antibody (A00758-1).
SOX10 was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-SOX10 Antibody (A00758-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For SOX10 (Source: Uniprot.org, NCBI)
Gene Name
SOX10
Full Name
Transcription factor SOX-10
Weight
49,911MW
Alternative Names
Transcription factor SOX-10; SOX10 SOX10 DOM, PCWH, WS2E, WS4, WS4C SRY-box transcription factor 10 transcription factor SOX-10|SRY (sex determining region Y)-box 10|SRY-box 10|SRY-related HMG-box gene 10|dominant megacolon, mouse, human homolog of
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SOX10, check out the SOX10 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SOX10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SOX10 Antibody Picoband® (A00758-1)
Hello CJ!
No publications found for A00758-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SOX10 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SOX10 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-SOX10 Antibody Picoband®
Question
Do you have a BSA free version of anti-SOX10 antibody A00758-1 available?
Verified Customer
Verified customer
Asked: 2020-04-24
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SOX10 antibody A00758-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-24
Question
We are currently using anti-SOX10 antibody A00758-1 for human tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
The anti-SOX10 antibody (A00758-1) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-04-09
Question
My question regarding product A00758-1, anti-SOX10 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-04-03
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00758-1 anti-SOX10 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-04-03
Question
Is a blocking peptide available for product anti-SOX10 antibody (A00758-1)?
Verified Customer
Verified customer
Asked: 2020-01-27
Answer
We do provide the blocking peptide for product anti-SOX10 antibody (A00758-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-27
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta skin using anti-SOX10 antibody A00758-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-21
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-21
Question
Our lab were happy with the WB result of your anti-SOX10 antibody. However we have been able to see positive staining in inferior olivary complex cytoplasm. using this antibody. Is that expected? Could you tell me where is SOX10 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-06-05
Answer
From what I have seen in literature, inferior olivary complex does express SOX10. Generally SOX10 expresses in cytoplasm. Regarding which tissues have SOX10 expression, here are a few articles citing expression in various tissues:
Placenta, and Skin, Pubmed ID: 15489334
Small intestine, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-06-05
Question
I was wanting to use your anti-SOX10 antibody for Flow Cytometry for rat placenta skin on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat placenta skin identification?
Verified Customer
Verified customer
Asked: 2019-01-14
Answer
You can see on the product datasheet, A00758-1 anti-SOX10 antibody has been tested for Flow Cytometry, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat placenta skin in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-01-14
Question
Does A00758-1 anti-SOX10 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-09-03
Answer
You can see on the product datasheet, A00758-1 anti-SOX10 antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-09-03
Question
Is this A00758-1 anti-SOX10 antibody reactive to the isotypes of SOX10?
Verified Customer
Verified customer
Asked: 2018-08-14
Answer
The immunogen of A00758-1 anti-SOX10 antibody is A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-08-14
Question
We purchased anti-SOX10 antibody for Flow Cytometry on placenta skin a few months ago. I am using rat, and We intend to use the antibody for WB next. I am interested in examining placenta skin as well as inferior olivary complex in our next experiment. Could give a recommendation on which antibody would work the best for WB?
A. Zhang
Verified customer
Asked: 2018-03-23
Answer
I took a look at the website and datasheets of our anti-SOX10 antibody and it seems that A00758-1 has been tested on rat in both Flow Cytometry and WB. Thus A00758-1 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-03-23
Question
We have observed staining in mouse placenta skin. Do you have any suggestions? Is anti-SOX10 antibody supposed to stain placenta skin positively?
P. Taylor
Verified customer
Asked: 2015-10-07
Answer
Based on literature placenta skin does express SOX10. Based on Uniprot.org, SOX10 is expressed in inferior olivary complex, small intestine, placenta skin, among other tissues. Regarding which tissues have SOX10 expression, here are a few articles citing expression in various tissues:
Placenta, and Skin, Pubmed ID: 15489334
Small intestine, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2015-10-07
Question
Will anti-SOX10 antibody A00758-1 work for Flow Cytometry with placenta skin?
A. Walker
Verified customer
Asked: 2014-11-11
Answer
According to the expression profile of placenta skin, SOX10 is highly expressed in placenta skin. So, it is likely that anti-SOX10 antibody A00758-1 will work for Flow Cytometry with placenta skin.
Boster Scientific Support
Answered: 2014-11-11
Question
See attached the WB image, lot number and protocol we used for placenta skin using anti-SOX10 antibody A00758-1. Please let me know if you require anything else.
J. Bhatt
Verified customer
Asked: 2014-06-30
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2014-06-30
Question
I see that the anti-SOX10 antibody A00758-1 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
A. Li
Verified customer
Asked: 2014-04-15
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-04-15
Question
I was wanting to use to test anti-SOX10 antibody A00758-1 on rat placenta skin for research purposes, then I may be interested in using anti-SOX10 antibody A00758-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
D. Evans
Verified customer
Asked: 2013-11-14
Answer
The products we sell, including anti-SOX10 antibody A00758-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2013-11-14
Question
I am interested in using your anti-SOX10 antibody for enteric nervous system development studies. Has this antibody been tested with western blotting on u20s cells? We would like to see some validation images before ordering.
M. Parker
Verified customer
Asked: 2013-04-09
Answer
Thanks for your inquiry. This A00758-1 anti-SOX10 antibody is tested on human a375 cell lysate, u20s cells. It is guaranteed to work for Flow Cytometry, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2013-04-09
