ISCU (NM_014301) Human Recombinant Protein

ISCU protein,

Product Info Summary

SKU: PROTQ9H1K1
Size: 20 µg
Source: HEK293T

Product Name

ISCU (NM_014301) Human Recombinant Protein

View all ISCU recombinant proteins

SKU/Catalog Number

PROTQ9H1K1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ISCU (NM_014301) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H1K1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.1 kDa

Amino Acid Sequence

MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Validation Images & Assay Conditions

Gene/Protein Information For ISCU (Source: Uniprot.org, NCBI)

Gene Name

ISCU

Full Name

Iron-sulfur cluster assembly enzyme ISCU, mitochondrial

Weight

15.1 kDa

Superfamily

NifU family

Alternative Names

2310020H20Rik; HML; hnifU; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; iron-sulfur cluster scaffold homolog (E. coli); IscU iron-sulfur cluster scaffold homolog (E. coli); IscU iron-sulfur cluster scaffold homolog; IscU; ISU2; MGC74517; NIFU; NifU-like N-terminal domain containing; NifU-like N-terminal domain-containing protein; NifU-like protein; NIFUN ISCU 2310020H20Rik, HML, ISU2, NIFU, NIFUN, hnifU iron-sulfur cluster assembly enzyme iron-sulfur cluster assembly enzyme ISCU, mitochondrial|IscU iron-sulfur cluster scaffold homolog|nifU-like N-terminal domain-containing protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ISCU, check out the ISCU Infographic

ISCU infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ISCU: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H1K1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ISCU (NM_014301) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ISCU (NM_014301) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ISCU (NM_014301) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H1K1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.