Product Info Summary
SKU: | PB10098 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IF, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PC4/SUB1 Antibody Picoband®
SKU/Catalog Number
PB10098
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PC4/SUB1 Antibody Picoband® catalog # PB10098. Tested in IF, IHC WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PC4/SUB1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10098)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PC4, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10098 is reactive to SUB1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
19 kDa
Calculated molecular weight
14395 MW
Background of SUB1
Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10098 is guaranteed for IF, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Immunofluorescence, 5 μg/ml, Human
Positive Control
WB: human Hela whole cell, human A549 whole cell, human MCF-7 whole cell, human T47D whole cell, human PC-3 whole cell, human Jurkat whole cell, human placenta tissue, human HL-60 whole cell, rat liver tissue, rat spleen tissue, rat stomach tissue, rat RH35 whole cell, mouse liver tissue, mosue spleen tissue
IHC: human esophageal squamous carcinoma tissue, human endometrioid adenocarcinoma type I tissue
IF: human intestinal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PC4/SUB1 using anti-PC4/SUB1 antibody (PB10098).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human A549 whole cell lysates,
Lane 3: human MCF-7 whole cell lysates,
Lane 4: human T47D whole cell lysates,
Lane 5: human PC-3 whole cell lysates,
Lane 6: human Jurkat whole cell lysates,
Lane 7: human placenta tissue lysates,
Lane 8: human HL-60 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PC4/SUB1 antigen affinity purified polyclonal antibody (Catalog # PB10098) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PC4/SUB1 at approximately 19 kDa. The expected band size for PC4/SUB1 is at 14 kDa.
Click image to see more details
Figure 2. Western blot analysis of PC4/SUB1 using anti-PC4/SUB1 antibody (PB10098).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: rat spleen tissue lysates,
Lane 3: rat stomach tissue lysates,
Lane 4: rat RH35 whole cell lysates,
Lane 5: mouse liver tissue lysates,
Lane 6: mosue spleen tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PC4/SUB1 antigen affinity purified polyclonal antibody (Catalog # PB10098) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PC4/SUB1 at approximately 19 kDa. The expected band size for PC4/SUB1 is at 14 kDa.
Click image to see more details
Figure 3. IHC analysis of PC4/SUB1 using anti-PC4/SUB1 antibody (PB10098).
PC4/SUB1 was detected in a paraffin-embedded section of human esophageal squamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-PC4/SUB1 Antibody (PB10098) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of PC4/SUB1 using anti-PC4/SUB1 antibody (PB10098).
PC4/SUB1 was detected in a paraffin-embedded section of human endometrioid adenocarcinoma type I tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-PC4/SUB1 Antibody (PB10098) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of PC4/SUB1 using anti-PC4/SUB1 antibody (PB10098).
PC4/SUB1 was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 μg/mL rabbit anti-PC4/SUB1 Antibody (PB10098) overnight at 4°C. DyLight488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For SUB1 (Source: Uniprot.org, NCBI)
Gene Name
SUB1
Full Name
Activated RNA polymerase II transcriptional coactivator p15
Weight
14395 MW
Superfamily
transcriptional coactivator PC4 family
Alternative Names
Activated RNA polymerase II transcriptional coactivator p15;Positive cofactor 4;PC4;SUB1 homolog;p14;SUB1;PC4, RPO2TC1; SUB1 P15, PC4, p14 SUB1 regulator of transcription activated RNA polymerase II transcriptional coactivator p15|SUB1 homolog, transcriptional regulator|activated RNA polymerase II transcription cofactor 4|positive cofactor 4
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SUB1, check out the SUB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SUB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PC4/SUB1 Antibody Picoband® (PB10098)
Hello CJ!
No publications found for PB10098
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PC4/SUB1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-PC4/SUB1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-PC4/SUB1 Antibody Picoband®
Question
Does PB10098 anti-PC4/SUB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-12-26
Answer
It shows on the product datasheet, PB10098 anti-PC4/SUB1 antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-26
Question
Is this PB10098 anti-PC4/SUB1 antibody reactive to the isotypes of SUB1?
Verified Customer
Verified customer
Asked: 2019-09-19
Answer
The immunogen of PB10098 anti-PC4/SUB1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-19
Question
Would anti-PC4/SUB1 antibody PB10098 work for Flow Cytometry with cervix carcinoma erythroleukemia?
Verified Customer
Verified customer
Asked: 2019-05-16
Answer
According to the expression profile of cervix carcinoma erythroleukemia, SUB1 is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-PC4/SUB1 antibody PB10098 will work for Flow Cytometry with cervix carcinoma erythroleukemia.
Boster Scientific Support
Answered: 2019-05-16
Question
Is a blocking peptide available for product anti-PC4/SUB1 antibody (PB10098)?
M. Mangal
Verified customer
Asked: 2019-04-24
Answer
We do provide the blocking peptide for product anti-PC4/SUB1 antibody (PB10098). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-04-24
Question
Would anti-PC4/SUB1 antibody PB10098 work on pig WB with cervix carcinoma?
Verified Customer
Verified customer
Asked: 2018-10-09
Answer
Our lab technicians have not tested anti-PC4/SUB1 antibody PB10098 on pig. You can run a BLAST between pig and the immunogen sequence of anti-PC4/SUB1 antibody PB10098 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig cervix carcinoma in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-10-09
Question
We are currently using anti-PC4/SUB1 antibody PB10098 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2018-01-04
Answer
The anti-PC4/SUB1 antibody (PB10098) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-01-04