Product Info Summary
SKU: | PROTP02778 |
---|---|
Size: | 5ug, 25ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IP-10 Human Recombinant Protein (CXCL10)
View all CXCL10/IP-10/CRG-2 recombinant proteins
SKU/Catalog Number
PROTP02778
Size
5ug, 25ug, 1mg
Description
IP-10 Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IP-10 Human Recombinant Protein (CXCL10) (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02778)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Purity
Greater than 95.0% as determined by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For CXCL10 (Source: Uniprot.org, NCBI)
Gene Name
CXCL10
Full Name
C-X-C motif chemokine 10
Weight
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
C7; chemokine (C-X-C motif) ligand 10; CRG2; CRG-2; CXCL10; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 CXCL10 C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1 C-X-C motif chemokine ligand 10 C-X-C motif chemokine 10|10 kDa interferon gamma-induced protein|gamma IP10|interferon-inducible cytokine IP-10|protein 10 from interferon (gamma)-induced cell line|small inducible cytokine subfamily B (Cys-X-Cys), member 10|small-inducible cytokine B10
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL10, check out the CXCL10 Infographic
![CXCL10 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IP-10 Human Recombinant Protein (CXCL10) (PROTP02778)
Hello CJ!
No publications found for PROTP02778
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IP-10 Human Recombinant Protein (CXCL10)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IP-10 Human Recombinant Protein (CXCL10)
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
1 Customer Q&As for IP-10 Human Recombinant Protein (CXCL10)
Question
Is PROTP02778 biologically active?
Verified customer
Asked: 2019-11-25
Answer
Only some of our recombinant protein has been tested and those would have a biological activity section mentioned in https://www.bosterbio.com/datasheet?sku=PROTP02778. If there is no biological activity section mentioned in our data sheet it means that we have not assessed the bio-functionality of the protein to date. So, we cannot guarantee that the protein is biologically active.
Boster Scientific Support
Answered: 2019-11-26