IP-10 Human Recombinant Protein (CXCL10)

CXCL10/IP-10/CRG-2 protein, Human

IP-10 Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP02778
Size: 5ug, 25ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

IP-10 Human Recombinant Protein (CXCL10)

View all CXCL10/IP-10/CRG-2 recombinant proteins

SKU/Catalog Number

PROTP02778

Size

5ug, 25ug, 1mg

Description

IP-10 Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

IP-10 Human Recombinant Protein (CXCL10) (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02778)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).

Purity

Greater than 95.0% as determined by SDS-PAGE.

Reconstitution

It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP

Reconstitution

It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL10 (Source: Uniprot.org, NCBI)

Gene Name

CXCL10

Full Name

C-X-C motif chemokine 10

Weight

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

C7; chemokine (C-X-C motif) ligand 10; CRG2; CRG-2; CXCL10; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 CXCL10 C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1 C-X-C motif chemokine ligand 10 C-X-C motif chemokine 10|10 kDa interferon gamma-induced protein|gamma IP10|interferon-inducible cytokine IP-10|protein 10 from interferon (gamma)-induced cell line|small inducible cytokine subfamily B (Cys-X-Cys), member 10|small-inducible cytokine B10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL10, check out the CXCL10 Infographic

CXCL10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP02778

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IP-10 Human Recombinant Protein (CXCL10)?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IP-10 Human Recombinant Protein (CXCL10)

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for IP-10 Human Recombinant Protein (CXCL10)

Question

Is PROTP02778 biologically active?

Verified customer

Asked: 2019-11-25

Answer

Only some of our recombinant protein has been tested and those would have a biological activity section mentioned in https://www.bosterbio.com/datasheet?sku=PROTP02778. If there is no biological activity section mentioned in our data sheet it means that we have not assessed the bio-functionality of the protein to date. So, we cannot guarantee that the protein is biologically active.

Boster Scientific Support

Answered: 2019-11-26

Size

Total: $250

SKU:PROTP02778

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP02778
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.