INCA (CARD17) (NM_001007232) Human Recombinant Protein

INCA protein,

Product Info Summary

SKU: PROTQ5XLA6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

INCA (CARD17) (NM_001007232) Human Recombinant Protein

View all INCA recombinant proteins

SKU/Catalog Number

PROTQ5XLA6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human caspase recruitment domain family, member 17 (CARD17)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

INCA (CARD17) (NM_001007232) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5XLA6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.7 kDa

Amino Acid Sequence

MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For CARD17 (Source: Uniprot.org, NCBI)

Gene Name

CARD17

Full Name

Caspase recruitment domain-containing protein 17

Weight

11.7 kDa

Alternative Names

caspase recruitment domain family, member 17; caspase recruitment domain-containing protein 17; Caspase-1 inhibitor INCA; INCAInhibitory CARD; inhibitory caspase recruitment domain (CARD) protein; Inhibitory caspase recruitment domain protein CARD17 INCA caspase recruitment domain family member 17 caspase recruitment domain-containing protein 17|Inhibitory CARD|caspase-1 inhibitor INCA|inhibitory caspase recruitment domain (CARD) protein|inhibitory caspase recruitment domain protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CARD17, check out the CARD17 Infographic

CARD17 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CARD17: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5XLA6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used INCA (CARD17) (NM_001007232) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For INCA (CARD17) (NM_001007232) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for INCA (CARD17) (NM_001007232) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5XLA6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.