IMPA1 (NM_005536) Human Recombinant Protein

IMPA1 protein,

Product Info Summary

SKU: PROTP29218
Size: 20 µg
Source: HEK293T

Product Name

IMPA1 (NM_005536) Human Recombinant Protein

View all IMPA1 recombinant proteins

SKU/Catalog Number

PROTP29218

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human inositol (myo)-1 (or 4)-monophosphatase 1 (IMPA1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IMPA1 (NM_005536) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP29218)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30 kDa

Amino Acid Sequence

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

Validation Images & Assay Conditions

Gene/Protein Information For IMPA1 (Source: Uniprot.org, NCBI)

Gene Name

IMPA1

Full Name

Inositol monophosphatase 1

Weight

30 kDa

Superfamily

inositol monophosphatase superfamily

Alternative Names

EC 3.1.3.25; IMP 1; IMP; IMP1; IMPA; IMPA1; IMPase 1; inositol monophosphatase 1; inositol(myo)-1(or 4)-monophosphatase 1; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; MRT59; Myo-Inositol Monophosphatase 1 IMPA1 IMP, IMPA, MRT59 inositol monophosphatase 1 inositol monophosphatase 1|D-galactose 1-phosphate phosphatase|IMP 1|IMPase 1|inositol(myo)-1(or 4)-monophosphatase 1|inositol-1(or 4)-monophosphatase 1|lithium-sensitive myo-inositol monophosphatase A1|myo-inositol monophosphatase 1|testicular tissue protein Li 94

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IMPA1, check out the IMPA1 Infographic

IMPA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IMPA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP29218

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IMPA1 (NM_005536) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IMPA1 (NM_005536) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IMPA1 (NM_005536) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP29218
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.