IL22 (NM_020525) Human Recombinant Protein

IL-22 protein,

Product Info Summary

SKU: PROTQ9GZX6
Size: 20 µg
Source: HEK293T

Product Name

IL22 (NM_020525) Human Recombinant Protein

View all IL-22 recombinant proteins

SKU/Catalog Number

PROTQ9GZX6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interleukin 22 (IL22)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IL22 (NM_020525) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZX6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.8 kDa

Amino Acid Sequence

MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Validation Images & Assay Conditions

Gene/Protein Information For IL22 (Source: Uniprot.org, NCBI)

Gene Name

IL22

Full Name

Interleukin-22

Weight

19.8 kDa

Superfamily

IL-10 family

Alternative Names

Cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL22; IL-22; IL-D110; IL-TIF; ILTIFIL-10-related T-cell-derived-inducible factor; IL-TIFMGC79382; interleukin 22; interleukin-22; MGC79384; TIFa; TIFIL-23; zcyto18 IL22 IL-21, IL-22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18 interleukin 22 interleukin-22|IL-10-related T-cell-derived inducible factor|cytokine Zcyto18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL22, check out the IL22 Infographic

IL22 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL22: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZX6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL22 (NM_020525) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL22 (NM_020525) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL22 (NM_020525) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZX6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.