IL1RA (IL1RN) (NM_173843) Human Recombinant Protein

IL-1ra/IL-1F3/IL1RN protein,

Product Info Summary

SKU: PROTP18510
Size: 20 µg
Source: HEK293T

Product Name

IL1RA (IL1RN) (NM_173843) Human Recombinant Protein

View all IL-1ra/IL-1F3/IL1RN recombinant proteins

SKU/Catalog Number

PROTP18510

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IL1RA (IL1RN) (NM_173843) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18510)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16 kDa

Amino Acid Sequence

MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Validation Images & Assay Conditions

Gene/Protein Information For IL1RN (Source: Uniprot.org, NCBI)

Gene Name

IL1RN

Full Name

Interleukin-1 receptor antagonist protein

Weight

16 kDa

Alternative Names

DIRA; ICIL-1ra; IL1F3; IL-1F3; IL1ra; IL-1ra; IL-1ra3; IL1RN; IL-1RN; interleukin 1 receptor antagonist; IRAP; MVCD4 IL1RN DIRA, ICIL-1RA, IL-1RN, IL-1ra, IL-1ra3, IL1F3, IL1RA, IRAP, MVCD4 interleukin 1 receptor antagonist interleukin-1 receptor antagonist protein|IL1 inhibitor|intracellular IL-1 receptor antagonist type II|intracellular interleukin-1 receptor antagonist (icIL-1ra)|type II interleukin-1 receptor antagonist

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL1RN, check out the IL1RN Infographic

IL1RN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL1RN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP18510

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL1RA (IL1RN) (NM_173843) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL1RA (IL1RN) (NM_173843) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL1RA (IL1RN) (NM_173843) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP18510
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.