Click image to see more details
Product Info Summary
| SKU: | PROTO14788-6 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand) protein, AF
View all TRANCE/TNFSF11/RANK L recombinant proteins
SKU/Catalog Number
PROTO14788-6
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Receptor activator of NF-κB (RANK) ligand (RANKL) is type II transmembrane protein with an extracellular domain at the carboxy-terminus of TNF cytokine superfamily. RANKL is a 19.8 kDa protein containing 317 residues and high express in T cells and T cell rich organs, such as thymus and lymph nodes. RANKL-RANK (RANKL receptor) plays an important role in bone metabolism, dysregulation, and immune system.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14788-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
35.478kDa
Molecular weight
The protein has a calculated MW of 20.67 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human RANKL
Protein Target Info & Infographic
Gene/Protein Information For TNFSF11 (Source: Uniprot.org, NCBI)
Gene Name
TNFSF11
Full Name
Tumor necrosis factor ligand superfamily member 11
Weight
35.478kDa
Superfamily
tumor necrosis factor family
Alternative Names
soluble Receptor Activator of NF-kB Ligand, TNFSF11, TRANCE (TNF-Related Activation-induced Cytokine), OPGL, ODF (Osteoclast Differentiation Factor), CD254,sRNAK Ligand TNFSF11 CD254, ODF, OPGL, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2, sOdf TNF superfamily member 11 tumor necrosis factor ligand superfamily member 11|TNF-related activation-induced cytokine|osteoclast differentiation factor|osteoprotegerin ligand|receptor activator of nuclear factor kappa B ligand|tumor necrosis factor (ligand) superfamily, member 11|tumor necrosis factor ligand 6B|tumor necrosis factor superfamily member 11
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFSF11, check out the TNFSF11 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFSF11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand) protein, AF (PROTO14788-6)
Hello CJ!
No publications found for PROTO14788-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
