Click image to see more details
Product Info Summary
| SKU: | PROTP08253-4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant MMP2 (active) protein, AF
View all MMP-2 recombinant proteins
SKU/Catalog Number
PROTP08253-4
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Active matrix metalloproteinase-2 (Active MMP-2) is a 63 kDa matrix metalloproteinases with 558 amino acid residues. MMP-2 is mainly expressed from extracellular matrix organization. Functionally, it can degrade type IV collagen and involves processes of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant MMP2 (active) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP08253-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
73.882kDa
Molecular weight
The protein has a calculated MW of 63.00 kDa. The protein migrates as 66 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human MMP2 (active)
Protein Target Info & Infographic
Gene/Protein Information For MMP2 (Source: Uniprot.org, NCBI)
Gene Name
MMP2
Full Name
72 kDa type IV collagenase
Weight
73.882kDa
Superfamily
peptidase M10A family
Alternative Names
Gelatinase A, TBE-1, MMP-II, MONA MMP2 CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1 matrix metallopeptidase 2 72 kDa type IV collagenase|collagenase type IV-A|matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)|matrix metalloproteinase-2|matrix metalloproteinase-II|neutrophil gelatinase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MMP2, check out the MMP2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MMP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant MMP2 (active) protein, AF (PROTP08253-4)
Hello CJ!
No publications found for PROTP08253-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant MMP2 (active) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant MMP2 (active) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
