HSPC014 (POMP) (NM_015932) Human Recombinant Protein

HSPC014 protein,

Recombinant protein of human proteasome maturation protein (POMP)

Product Info Summary

SKU: PROTQ9Y244
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HSPC014 (POMP) (NM_015932) Human Recombinant Protein

View all HSPC014 recombinant proteins

SKU/Catalog Number

PROTQ9Y244

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human proteasome maturation protein (POMP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HSPC014 (POMP) (NM_015932) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y244)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.6 kDa

Amino Acid Sequence

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL

Validation Images & Assay Conditions

Gene/Protein Information For POMP (Source: Uniprot.org, NCBI)

Gene Name

POMP

Full Name

Proteasome maturation protein

Weight

15.6 kDa

Superfamily

POMP/UMP1 family

Alternative Names

C13orf12; chromosome 13 open reading frame 12; HSPC014; hUMP1; PNAS-110; proteasome maturation protein; proteassemblin; Protein UMP1 homolog; UMP12510048O06Rik; Voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1 POMP C13orf12, HSPC014, PNAS-110, PRAAS2, UMP1 proteasome maturation protein proteasome maturation protein|2510048O06Rik|hUMP1|proteassemblin|protein UMP1 homolog|voltage-gated K channel beta subunit 4.1|voltage-gated potassium channel beta subunit 4.1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POMP, check out the POMP Infographic

POMP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POMP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y244

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HSPC014 (POMP) (NM_015932) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HSPC014 (POMP) (NM_015932) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HSPC014 (POMP) (NM_015932) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y244
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.