HSBP1 (NM_001537) Human Recombinant Protein

HSBP1 protein,

Product Info Summary

SKU: PROTO75506
Size: 20 µg
Source: HEK293T

Product Name

HSBP1 (NM_001537) Human Recombinant Protein

View all HSBP1 recombinant proteins

SKU/Catalog Number

PROTO75506

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heat shock factor binding protein 1 (HSBP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HSBP1 (NM_001537) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75506)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.4 kDa

Amino Acid Sequence

MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS

Validation Images & Assay Conditions

Gene/Protein Information For HSBP1 (Source: Uniprot.org, NCBI)

Gene Name

HSBP1

Full Name

Heat shock factor-binding protein 1

Weight

8.4 kDa

Superfamily

HSBP1 family

Alternative Names

DKFZp686D1664; DKFZp686O24200; heat shock factor binding protein 1; heat shock factor-binding protein 1; HSF1BP; Nasopharyngeal carcinoma-associated antigen 13; NPC-A-13 HSBP1 NPC-A-13 heat shock factor binding protein 1 heat shock factor-binding protein 1|nasopharyngeal carcinoma-associated 13

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HSBP1, check out the HSBP1 Infographic

HSBP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSBP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75506

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HSBP1 (NM_001537) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HSBP1 (NM_001537) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HSBP1 (NM_001537) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75506
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.