hnRNP A1 (HNRNPA1) (NM_031157) Human Recombinant Protein

hnRNP A1 protein,

Product Info Summary

SKU: PROTP09651
Size: 20 µg
Source: HEK293T

Product Name

hnRNP A1 (HNRNPA1) (NM_031157) Human Recombinant Protein

View all hnRNP A1 recombinant proteins

SKU/Catalog Number

PROTP09651

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

hnRNP A1 (HNRNPA1) (NM_031157) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09651)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.6 kDa

Amino Acid Sequence

MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGFSSSSSYGSGRRF

Validation Images & Assay Conditions

Gene/Protein Information For HNRNPA1 (Source: Uniprot.org, NCBI)

Gene Name

HNRNPA1

Full Name

Heterogeneous nuclear ribonucleoprotein A1

Weight

38.6 kDa

Alternative Names

Helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP core protein A1; hnRNPA1; hnRNP-A1; HNRPA1MGC102835; nuclear ribonucleoprotein particle A1 protein; single-strand DNA-binding protein UP1; Single-strand RNA-binding protein HNRNPA1 ALS19, ALS20, HNRPA1, HNRPA1L3, IBMPFD3, UP 1, hnRNP A1, hnRNP-A1 heterogeneous nuclear ribonucleoprotein A1 heterogeneous nuclear ribonucleoprotein A1|epididymis secretory sperm binding protein|helix-destabilizing protein|heterogeneous nuclear ribonucleoprotein A1B protein|heterogeneous nuclear ribonucleoprotein B2 protein|heterogeneous nuclear ribonucleoprotein core protein A1|hnRNP core protein A1-like 3|nuclear ribonucleoprotein particle A1 protein|putative heterogeneous nuclear ribonucleoprotein A1-like 3|single-strand DNA-binding protein UP1|single-strand RNA-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HNRNPA1, check out the HNRNPA1 Infographic

HNRNPA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HNRNPA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09651

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used hnRNP A1 (HNRNPA1) (NM_031157) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For hnRNP A1 (HNRNPA1) (NM_031157) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for hnRNP A1 (HNRNPA1) (NM_031157) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09651
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.