HMGA2 (NM_003484) Human Recombinant Protein

HMGA2 protein,

Product Info Summary

SKU: PROTP52926
Size: 20 µg
Source: HEK293T

Product Name

HMGA2 (NM_003484) Human Recombinant Protein

View all HMGA2 recombinant proteins

SKU/Catalog Number

PROTP52926

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human high mobility group AT-hook 2 (HMGA2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HMGA2 (NM_003484) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP52926)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.3 kDa

Amino Acid Sequence

MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWDNLLPRTSSKKKTSLGNSTKRSH

Validation Images & Assay Conditions

Gene/Protein Information For HMGA2 (Source: Uniprot.org, NCBI)

Gene Name

HMGA2

Full Name

High mobility group protein HMGI-C

Weight

11.3 kDa

Superfamily

HMGA family

Alternative Names

BABL; BABLHMGI-C; high mobility group AT-hook 2; High mobility group AT-hook protein 2; high mobility group protein HMGI-C; high-mobility group (nonhistone chromosomal) protein isoform I-C; High-mobility group protein HMGI-C; HMGA2; HMGIC; HMGICSTQTL9; LIPO HMGA2 BABL, HMGI-C, HMGIC, LIPO, SRS5, STQTL9 high mobility group AT-hook 2 high mobility group protein HMGI-C|HMGA2/KRT121P fusion

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HMGA2, check out the HMGA2 Infographic

HMGA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HMGA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP52926

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HMGA2 (NM_003484) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HMGA2 (NM_003484) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HMGA2 (NM_003484) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP52926
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.