HES4 (NM_001142467) Human Recombinant Protein

HES-4 protein,

Recombinant protein of human hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1

Product Info Summary

SKU: PROTQ9HCC6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HES4 (NM_001142467) Human Recombinant Protein

View all HES-4 recombinant proteins

SKU/Catalog Number

PROTQ9HCC6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HES4 (NM_001142467) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HCC6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.9 kDa

Amino Acid Sequence

MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR

Validation Images & Assay Conditions

Gene/Protein Information For HES4 (Source: Uniprot.org, NCBI)

Gene Name

HES4

Full Name

Transcription factor HES-4

Weight

25.9 kDa

Alternative Names

bHLH factor Hes4; BHLHB42; bHLHb42transcription factor HES-4; Class B basic helix-loop-helix protein 42; hairy and enhancer of split 4 (Drosophila); Hairy and enhancer of split 4; HES4; HES-4; hHES4 HES4 bHLHb42 hes family bHLH transcription factor 4 transcription factor HES-4|bHLH factor Hes4|class B basic helix-loop-helix protein 42|hHES4|hairy and enhancer of split 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HES4, check out the HES4 Infographic

HES4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HES4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HCC6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HES4 (NM_001142467) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HES4 (NM_001142467) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HES4 (NM_001142467) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HCC6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.