GUCA2B Prouroguanylin Human Recombinant Protein

Uroguanylin protein, Human

Prouroguanylin Human Recombinant is 10.7 kDa protein containing 86 amino acid residues of the human prouroguanylin and 10 additional amino acid His Tag. The Prouroguanylin is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ16661
Size: 2ug, 10ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

GUCA2B Prouroguanylin Human Recombinant Protein

View all Uroguanylin recombinant proteins

SKU/Catalog Number

PROTQ16661

Size

2ug, 10ug, 1mg

Description

Prouroguanylin Human Recombinant is 10.7 kDa protein containing 86 amino acid residues of the human prouroguanylin and 10 additional amino acid His Tag. The Prouroguanylin is purified by proprietary chromatographic techniques.

Storage & Handling

Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

Cite This Product

GUCA2B Prouroguanylin Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16661)

Form

Sterile Filtered clear solution.

Formulation

20mM TRIS, 50mM NaCl and 20% (v/v) glycerol, pH 7.5.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Amino Acid Sequence

VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLP AVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Validation Images & Assay Conditions

Gene/Protein Information For GUCA2B (Source: Uniprot.org, NCBI)

Gene Name

GUCA2B

Full Name

Guanylate cyclase activator 2B

Weight

Superfamily

guanylin family

Alternative Names

GCAP-II; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; UGN; uroguanylin GUCA2B GCAP-II, UGN guanylate cyclase activator 2B guanylate cyclase activator 2B|prepro-uroguanylin|uroguanylin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GUCA2B, check out the GUCA2B Infographic

GUCA2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GUCA2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16661

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GUCA2B Prouroguanylin Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GUCA2B Prouroguanylin Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GUCA2B Prouroguanylin Human Recombinant Protein

Size

Total: $250

SKU:PROTQ16661

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ16661
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.