GPS2 (NM_004489) Human Recombinant Protein

GPS2 protein,

Purified recombinant protein of Homo sapiens G protein pathway suppressor 2 (GPS2)

Product Info Summary

SKU: PROTQ13227
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GPS2 (NM_004489) Human Recombinant Protein

View all GPS2 recombinant proteins

SKU/Catalog Number

PROTQ13227

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens G protein pathway suppressor 2 (GPS2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GPS2 (NM_004489) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13227)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.5 kDa

Amino Acid Sequence

MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK

Validation Images & Assay Conditions

Gene/Protein Information For GPS2 (Source: Uniprot.org, NCBI)

Gene Name

GPS2

Full Name

G protein pathway suppressor 2

Weight

36.5 kDa

Alternative Names

AMF-1; G protein pathway suppressor 2; GPS-2; MGC104294; MGC119287; MGC119288; MGC119289 GPS2 AMF-1 G protein pathway suppressor 2 G protein pathway suppressor 2|GPS-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GPS2, check out the GPS2 Infographic

GPS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GPS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13227

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GPS2 (NM_004489) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GPS2 (NM_004489) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GPS2 (NM_004489) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13227
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.