GPR149 (NM_001038705) Human Recombinant Protein

Gpr149 protein,

Recombinant protein of human G protein-coupled receptor 149 (GPR149)

Product Info Summary

SKU: PROTQ86SP6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GPR149 (NM_001038705) Human Recombinant Protein

View all Gpr149 recombinant proteins

SKU/Catalog Number

PROTQ86SP6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human G protein-coupled receptor 149 (GPR149)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GPR149 (NM_001038705) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86SP6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

80.8 kDa

Amino Acid Sequence

MSLFLSNLSTNDSSLWKENHNSTDLLNPPGTLNIYLFCLTCLMTFAALVGSIYSLISLLKMQNRTVVSMLVASWSVDDLMSVLSVTIFMFLQWPNEVPGYFQFLCTTSALMYLCQGLSSNLKATLLVSYNFYTMHRGVGSQTASRRSGQVLGVVLTVWAASLLLSALPLCGWGAFVRTPWGCLVDCSSSYVLFLSIVYALAFGLLVGLSVPLTHRLLCSEEPPRLHSNYQEISRGASIPGTPPTAGRVVSLSPEDAPGPSLRRSGGCSPSSDTVFGPGAPAAAGAEACRRENRGTLYGTRSFTVSVAQKRFALILALTKVVLWLPMMMHMVVQNVVGFQSLPLETFSFLLTLLATTVTPVFVLSKRWTHLPCGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKSYGIYKIAHEDYYDDDENSIFYHNLMNSECETTKDPQRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNTDITEAKQDSNNKKDAFSDKTGGDINYEETTFSEGPERRLSHEESQKPDLSDWEWCRSKSERTPRQRSGYALAIPLCAFQGTVSLHAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGHEPNSEDSSSTFVDTSVKIHLEVLEICDNEEALDTVSIISNISQSSTQVRSPSLRYSRKENRFVSCDLGETASYSLFLPTSNPDGDINISIPDTVEAHRQNSKRQHQERDGYQEEIQLLNKAYRKREEESKGS

Validation Images & Assay Conditions

Gene/Protein Information For Gpr149 (Source: Uniprot.org, NCBI)

Gene Name

Gpr149

Full Name

Probable G-protein coupled receptor 149

Weight

80.8 kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

G protein-coupled receptor 149; G protein-coupled receptor PGR10; GPR149; G-protein coupled receptor PGR10; IEDA; PGR10; PGR10IEDA; probable G-protein coupled receptor 149 Gpr149|Ieda|G protein-coupled receptor 149|probable G-protein coupled receptor 149|induced early in differentiating astrocytes gene protein|orphan seven transmembrane receptor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Gpr149, check out the Gpr149 Infographic

Gpr149 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Gpr149: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ86SP6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GPR149 (NM_001038705) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GPR149 (NM_001038705) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GPR149 (NM_001038705) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86SP6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.