GNGT1 (NM_021955) Human Recombinant Protein

GNGT1 protein,

Product Info Summary

SKU: PROTP63211
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GNGT1 (NM_021955) Human Recombinant Protein

View all GNGT1 recombinant proteins

SKU/Catalog Number

PROTP63211

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GNGT1 (NM_021955) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63211)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.3 kDa

Amino Acid Sequence

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS

Validation Images & Assay Conditions

Gene/Protein Information For GNGT1 (Source: Uniprot.org, NCBI)

Gene Name

GNGT1

Full Name

Guanine nucleotide-binding protein G(T) subunit gamma-T1

Weight

8.3 kDa

Superfamily

G protein gamma family

Alternative Names

GNG1; guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 1; guanine nucleotide-binding protein G(T) subunit gamma-T1; Transducin gamma chain GNGT1 GNG1 G protein subunit gamma transducin 1 guanine nucleotide-binding protein G(T) subunit gamma-T1|guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1|transducin gamma chain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GNGT1, check out the GNGT1 Infographic

GNGT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GNGT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP63211

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GNGT1 (NM_021955) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GNGT1 (NM_021955) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GNGT1 (NM_021955) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP63211
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.