Glycerol kinase (GK) (NM_000167) Human Recombinant Protein

Glycerol Kinase protein,

Recombinant protein of human glycerol kinase (GK), transcript variant 2

Product Info Summary

SKU: PROTP32189
Size: 20 µg
Source: HEK293T

Product Name

Glycerol kinase (GK) (NM_000167) Human Recombinant Protein

View all Glycerol Kinase recombinant proteins

SKU/Catalog Number

PROTP32189

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glycerol kinase (GK), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Glycerol kinase (GK) (NM_000167) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP32189)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

57.3 kDa

Amino Acid Sequence

MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP

Validation Images & Assay Conditions

Gene/Protein Information For GK (Source: Uniprot.org, NCBI)

Gene Name

GK

Full Name

Glycerol kinase

Weight

57.3 kDa

Superfamily

FGGY kinase family

Alternative Names

ATP:glycerol 3-phosphotransferase; EC 2.7.1.30; GK; GK1; GKD; glpK; Glycerokinase; Glycerol Kinase GK GK1D, GK glycerol kinase glycerol kinase|ATP:glycerol 3-phosphotransferase|glycerokinase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GK, check out the GK Infographic

GK infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GK: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP32189

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Glycerol kinase (GK) (NM_000167) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Glycerol kinase (GK) (NM_000167) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Glycerol kinase (GK) (NM_000167) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP32189
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.