GADD45B (NM_015675) Human Recombinant Protein

MYD118 protein,

Product Info Summary

SKU: PROTO75293
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GADD45B (NM_015675) Human Recombinant Protein

View all MYD118 recombinant proteins

SKU/Catalog Number

PROTO75293

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GADD45B (NM_015675) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75293)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.6 kDa

Amino Acid Sequence

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Validation Images & Assay Conditions

Gene/Protein Information For GADD45B (Source: Uniprot.org, NCBI)

Gene Name

GADD45B

Full Name

Growth arrest and DNA damage-inducible protein GADD45 beta

Weight

17.6 kDa

Superfamily

GADD45 family

Alternative Names

DKFZp566B133; GADD45BETA; growth arrest and DNA damage-inducible protein GADD45 beta; growth arrest and DNA-damage-inducible, beta; MYD118DKFZP566B133; Myeloid differentiation primary response protein MyD118; Negative growth regulatory protein MyD118 GADD45B GADD45BETA, MYD118 growth arrest and DNA damage inducible beta growth arrest and DNA damage-inducible protein GADD45 beta|myeloid differentiation primary response protein MyD118|negative growth regulatory protein MyD118

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GADD45B, check out the GADD45B Infographic

GADD45B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GADD45B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75293

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GADD45B (NM_015675) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GADD45B (NM_015675) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GADD45B (NM_015675) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75293
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.