G0S2 (NM_015714) Human Recombinant Protein

G0s2 protein,

Recombinant protein of human G0/G1switch 2 (G0S2)

Product Info Summary

SKU: PROTP27469
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

G0S2 (NM_015714) Human Recombinant Protein

View all G0s2 recombinant proteins

SKU/Catalog Number

PROTP27469

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human G0/G1switch 2 (G0S2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

G0S2 (NM_015714) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP27469)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.1 kDa

Amino Acid Sequence

METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For G0S2 (Source: Uniprot.org, NCBI)

Gene Name

G0S2

Full Name

G0/G1 switch protein 2

Weight

11.1 kDa

Alternative Names

G0/G1 switch regulatory protein 2; G0/G1switch 2; RP1-28O10.2 G0s2|AI255151, AV006465|G0/G1 switch gene 2|G0/G1 switch protein 2|G0S2-like protein|putative lymphocyte G0/G1 switch protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on G0S2, check out the G0S2 Infographic

G0S2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for G0S2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP27469

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used G0S2 (NM_015714) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For G0S2 (NM_015714) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for G0S2 (NM_015714) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP27469
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.