FOXS1 (NM_004118) Human Recombinant Protein

FOXS1 protein,

Recombinant protein of human forkhead box S1 (FOXS1)

Product Info Summary

SKU: PROTO43638
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FOXS1 (NM_004118) Human Recombinant Protein

View all FOXS1 recombinant proteins

SKU/Catalog Number

PROTO43638

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human forkhead box S1 (FOXS1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FOXS1 (NM_004118) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43638)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.3 kDa

Amino Acid Sequence

MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

Validation Images & Assay Conditions

Gene/Protein Information For FOXS1 (Source: Uniprot.org, NCBI)

Gene Name

FOXS1

Full Name

Forkhead box protein S1

Weight

35.3 kDa

Alternative Names

FKHL18; forkhead (Drosophila)-like 18; forkhead box protein S1; forkhead box S1; Forkhead-like 18 protein; forkhead-related activator 10; Forkhead-related transcription factor 10; forkhead-related transcription factor FREAC-10; FREAC-10; FREAC10forkhead-like 18 (Drosophila); MGC4544 FOXS1 FKHL18, FREAC10 forkhead box S1 forkhead box protein S1|FREAC-10|forkhead-like 18 protein|forkhead-related activator 10|forkhead-related transcription factor 10|forkhead-related transcription factor FREAC-10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FOXS1, check out the FOXS1 Infographic

FOXS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FOXS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43638

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FOXS1 (NM_004118) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FOXS1 (NM_004118) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FOXS1 (NM_004118) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43638
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.