FLRT1 (NM_013280) Human Recombinant Protein

FLRT1 protein,

Recombinant protein of human fibronectin leucine rich transmembrane protein 1 (FLRT1)

Product Info Summary

SKU: PROTQ9NZU1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FLRT1 (NM_013280) Human Recombinant Protein

View all FLRT1 recombinant proteins

SKU/Catalog Number

PROTQ9NZU1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fibronectin leucine rich transmembrane protein 1 (FLRT1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FLRT1 (NM_013280) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZU1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

73.9 kDa

Amino Acid Sequence

MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT

Validation Images & Assay Conditions

Gene/Protein Information For FLRT1 (Source: Uniprot.org, NCBI)

Gene Name

FLRT1

Full Name

Leucine-rich repeat transmembrane protein FLRT1

Weight

73.9 kDa

Alternative Names

fibronectin leucine rich transmembrane protein 1; Fibronectin-like domain-containing leucine-rich transmembrane protein 1; FLRT1; leucine-rich repeat transmembrane protein FLRT1; MGC21624; SPG68 FLRT1 SPG68 fibronectin leucine rich transmembrane protein 1 leucine-rich repeat transmembrane protein FLRT1|fibronectin-like domain-containing leucine-rich transmembrane protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FLRT1, check out the FLRT1 Infographic

FLRT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FLRT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NZU1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FLRT1 (NM_013280) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FLRT1 (NM_013280) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FLRT1 (NM_013280) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NZU1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.