FKBP9 (NM_007270) Human Recombinant Protein

FKBP9 protein,

Recombinant protein of human FK506 binding protein 9, 63 kDa (FKBP9)

Product Info Summary

SKU: PROTO95302
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FKBP9 (NM_007270) Human Recombinant Protein

View all FKBP9 recombinant proteins

SKU/Catalog Number

PROTO95302

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human FK506 binding protein 9, 63 kDa (FKBP9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FKBP9 (NM_007270) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95302)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

62.9 kDa

Amino Acid Sequence

MAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL

Validation Images & Assay Conditions

Gene/Protein Information For FKBP9 (Source: Uniprot.org, NCBI)

Gene Name

FKBP9

Full Name

Peptidyl-prolyl cis-trans isomerase FKBP9

Weight

62.9 kDa

Alternative Names

63 kDa FK506-binding protein; DKFZp586B1723; FK506 binding protein 9, 63 kDa; FKBP60; FKBP63; FKBP-9; MGC126772,63 kDa FKBP; MGC138258; peptidyl-prolyl cis-trans isomerase FKBP9; PPIase; rotamase FKBP9 FKBP60, FKBP63, PPIase FKBP prolyl isomerase 9 peptidyl-prolyl cis-trans isomerase FKBP9|63 kDa FK506-binding protein|63 kDa FKBP|FK506 binding protein 9, 63 kDa|FK506-binding protein 9|FKBP-63|FKBP-9|PPIase FKBP9|rotamase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FKBP9, check out the FKBP9 Infographic

FKBP9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FKBP9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95302

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FKBP9 (NM_007270) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FKBP9 (NM_007270) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FKBP9 (NM_007270) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95302
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.