FKBP11 (NM_016594) Human Recombinant Protein

FKBP11 protein,

Recombinant protein of human FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1

Product Info Summary

SKU: PROTQ9NYL4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FKBP11 (NM_016594) Human Recombinant Protein

View all FKBP11 recombinant proteins

SKU/Catalog Number

PROTQ9NYL4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FKBP11 (NM_016594) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NYL4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.2 kDa

Amino Acid Sequence

MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK

Validation Images & Assay Conditions

Gene/Protein Information For FKBP11 (Source: Uniprot.org, NCBI)

Gene Name

FKBP11

Full Name

Peptidyl-prolyl cis-trans isomerase FKBP11

Weight

19.2 kDa

Superfamily

FKBP-type PPIase family

Alternative Names

19 kDa FK506-binding protein; EC 5.2.1.8; FK506 binding protein 11, 19 kDa; FK506-binding protein 11; FKBP-11; FKBP-19; FKBP19FK506 binding protein 11 (19 kDa); MGC54182,19 kDa FKBP; peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; rotamase FKBP11 FKBP19 FKBP prolyl isomerase 11 peptidyl-prolyl cis-trans isomerase FKBP11|19 kDa FK506-binding protein|19 kDa FKBP|FK506 binding protein 11, 19 kDa|FK506-binding protein 11|FKBP-11|FKBP-19|PPIase FKBP11|rotamase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FKBP11, check out the FKBP11 Infographic

FKBP11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FKBP11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NYL4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FKBP11 (NM_016594) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FKBP11 (NM_016594) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FKBP11 (NM_016594) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NYL4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.