FA2H (NM_024306) Human Recombinant Protein

FA2H protein,

Recombinant protein of human fatty acid 2-hydroxylase (FA2H)

Product Info Summary

SKU: PROTQ7L5A8
Size: 20 µg
Source: HEK293T

Product Name

FA2H (NM_024306) Human Recombinant Protein

View all FA2H recombinant proteins

SKU/Catalog Number

PROTQ7L5A8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fatty acid 2-hydroxylase (FA2H)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FA2H (NM_024306) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7L5A8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.6 kDa

Amino Acid Sequence

MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ

Validation Images & Assay Conditions

Gene/Protein Information For FA2H (Source: Uniprot.org, NCBI)

Gene Name

FA2H

Full Name

Fatty acid 2-hydroxylase

Weight

42.6 kDa

Superfamily

sterol desaturase family

Alternative Names

FAAHFAXDC1; FAH1; fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; FLJ25287; SCS7; spastic paraplegia 35 (autosomal recessive); SPG35 FA2H FAAH, FAH1, FAXDC1, SCS7, SPG35 fatty acid 2-hydroxylase fatty acid 2-hydroxylase|fatty acid alpha-hydroxylase|fatty acid hydroxylase domain containing 1|fatty acid hydroxylase domain-containing protein 1|spastic paraplegia 35 (autosomal recessive)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FA2H, check out the FA2H Infographic

FA2H infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FA2H: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7L5A8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FA2H (NM_024306) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FA2H (NM_024306) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FA2H (NM_024306) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7L5A8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.