ESAM (NM_138961) Human Recombinant Protein

Esam protein,

Recombinant protein of human endothelial cell adhesion molecule (ESAM)

Product Info Summary

SKU: PROTQ96AP7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ESAM (NM_138961) Human Recombinant Protein

View all Esam recombinant proteins

SKU/Catalog Number

PROTQ96AP7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human endothelial cell adhesion molecule (ESAM)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ESAM (NM_138961) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96AP7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41 kDa

Amino Acid Sequence

MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV

Validation Images & Assay Conditions

Gene/Protein Information For Esam (Source: Uniprot.org, NCBI)

Gene Name

Esam

Full Name

Endothelial cell-selective adhesion molecule

Weight

41 kDa

Alternative Names

2310008D05Rik; endothelial cell adhesion molecule; endothelial cell-selective adhesion molecule; ESAM; HUEL (C4orf1)-interacting protein; LP4791 protein; W117m Esam|2310008D05Rik1, W117m, Esam|endothelial cell-specific adhesion molecule|endothelial cell-selective adhesion molecule

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Esam, check out the Esam Infographic

Esam infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Esam: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96AP7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ESAM (NM_138961) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ESAM (NM_138961) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ESAM (NM_138961) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96AP7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.