ERK2 (MAPK1) (NM_138957) Human Recombinant Protein

ERK2 protein,

Product Info Summary

SKU: PROTP28482
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ERK2 (MAPK1) (NM_138957) Human Recombinant Protein

View all ERK2 recombinant proteins

SKU/Catalog Number

PROTP28482

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitogen-activated protein kinase 1 (MAPK1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ERK2 (MAPK1) (NM_138957) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP28482)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.2 kDa

Amino Acid Sequence

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Validation Images & Assay Conditions

Gene/Protein Information For MAPK1 (Source: Uniprot.org, NCBI)

Gene Name

MAPK1

Full Name

Mitogen-activated protein kinase 1

Weight

41.2 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.24; ERK; ERK2; ERK-2; ERK2MAP kinase isoform p42; ERT1; Extracellular signal-regulated kinase 2; MAP kinase 1; MAP kinase 2; MAPK 1; MAPK1; MAPK2; mitogen-activated protein kinase 1; Mitogen-activated protein kinase 2; p38; p40; p41; p41mapk; p42mapk; p42-MAPK; PRKM1; PRKM1MAPK 2; PRKM2; protein tyrosine kinase ERK2 MAPK1 ERK, ERK-2, ERK2, ERT1, MAPK2, NS13, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK mitogen-activated protein kinase 1 mitogen-activated protein kinase 1|MAP kinase 1|MAP kinase 2|MAPK 2|extracellular signal-regulated kinase 2|mitogen-activated protein kinase 2|protein tyrosine kinase ERK2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAPK1, check out the MAPK1 Infographic

MAPK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAPK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP28482

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERK2 (MAPK1) (NM_138957) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ERK2 (MAPK1) (NM_138957) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERK2 (MAPK1) (NM_138957) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP28482
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.