ENAH (NM_018212) Human Recombinant Protein

Mena protein,

Recombinant protein of human enabled homolog (Drosophila) (ENAH), transcript variant 2

Product Info Summary

SKU: PROTQ8N8S7
Size: 20 µg
Source: HEK293T

Product Name

ENAH (NM_018212) Human Recombinant Protein

View all Mena recombinant proteins

SKU/Catalog Number

PROTQ8N8S7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human enabled homolog (Drosophila) (ENAH), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ENAH (NM_018212) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N8S7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

63.7 kDa

Amino Acid Sequence

MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA

Validation Images & Assay Conditions

Gene/Protein Information For Enah (Source: Uniprot.org, NCBI)

Gene Name

Enah

Full Name

Protein enabled homolog

Weight

63.7 kDa

Superfamily

Ena/VASP family

Alternative Names

ENA; enabled homolog (Drosophila); ENAH; FLJ10773; Mena; MENANDPP1; NDPP1; protein enabled homolog Enah|Me, Mena, NDPP-1, Nd, Ndpp1, WBP8|ENAH actin regulator|protein enabled homolog|NPC derived proline rich protein 1|enabled homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Enah, check out the Enah Infographic

Enah infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Enah: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N8S7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ENAH (NM_018212) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ENAH (NM_018212) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ENAH (NM_018212) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N8S7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.