EIF5A2 (NM_020390) Human Recombinant Protein

EIF5A2 protein,

Product Info Summary

SKU: PROTQ9GZV4
Size: 20 µg
Source: HEK293T

Product Name

EIF5A2 (NM_020390) Human Recombinant Protein

View all EIF5A2 recombinant proteins

SKU/Catalog Number

PROTQ9GZV4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 5A2 (EIF5A2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF5A2 (NM_020390) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZV4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.6 kDa

Amino Acid Sequence

MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

Validation Images & Assay Conditions

Gene/Protein Information For EIF5A2 (Source: Uniprot.org, NCBI)

Gene Name

EIF5A2

Full Name

Eukaryotic translation initiation factor 5A-2

Weight

16.6 kDa

Superfamily

eIF-5A family

Alternative Names

EIF-5A2; eIF-5A-2; eIF5AII; Eukaryotic initiation factor 5A isoform 2; eukaryotic initiation factor 5A; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2 EIF5A2 EIF-5A2, eIF5AII eukaryotic translation initiation factor 5A2 eukaryotic translation initiation factor 5A-2|eIF-5A-2|eukaryotic initiation factor 5A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF5A2, check out the EIF5A2 Infographic

EIF5A2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF5A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZV4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF5A2 (NM_020390) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF5A2 (NM_020390) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF5A2 (NM_020390) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZV4
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.