DUSP23 (NM_017823) Human Recombinant Protein

DUSP23 protein,

Product Info Summary

SKU: PROTQ9BVJ7
Size: 20 µg
Source: HEK293T

Product Name

DUSP23 (NM_017823) Human Recombinant Protein

View all DUSP23 recombinant proteins

SKU/Catalog Number

PROTQ9BVJ7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dual specificity phosphatase 23 (DUSP23)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DUSP23 (NM_017823) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BVJ7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.4 kDa

Amino Acid Sequence

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK

Validation Images & Assay Conditions

Gene/Protein Information For DUSP23 (Source: Uniprot.org, NCBI)

Gene Name

DUSP23

Full Name

Dual specificity protein phosphatase 23

Weight

16.4 kDa

Superfamily

protein-tyrosine phosphatase family

Alternative Names

dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; EC 3.1.3.16; EC 3.1.3.48; FLJ20442; LDP3; LDP-3; Low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase 3; MOSP; RP11-190A12.1; VH1-like member Z; VH1-like phosphatase Z; VHZ DUSP23 DUSP25, LDP-3, LDP3, MOSP, VHZ dual specificity phosphatase 23 dual specificity protein phosphatase 23|VH1-like member Z|VH1-like phosphatase Z|low-molecular-mass dual-specificity phosphatase 3|testicular tissue protein Li 59

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DUSP23, check out the DUSP23 Infographic

DUSP23 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DUSP23: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BVJ7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DUSP23 (NM_017823) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DUSP23 (NM_017823) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DUSP23 (NM_017823) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BVJ7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.