DUSP14 (NM_007026) Human Recombinant Protein

DUSP14 protein,

Recombinant protein of human dual specificity phosphatase 14 (DUSP14)

Product Info Summary

SKU: PROTO95147
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DUSP14 (NM_007026) Human Recombinant Protein

View all DUSP14 recombinant proteins

SKU/Catalog Number

PROTO95147

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dual specificity phosphatase 14 (DUSP14)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DUSP14 (NM_007026) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95147)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.1 kDa

Amino Acid Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Validation Images & Assay Conditions

Gene/Protein Information For DUSP14 (Source: Uniprot.org, NCBI)

Gene Name

DUSP14

Full Name

Dual specificity protein phosphatase 14

Weight

22.1 kDa

Superfamily

protein-tyrosine phosphatase family

Alternative Names

dual specificity phosphatase 14; EC 3.1.3.16; EC 3.1.3.48; MAP kinase phosphatase 6; Mitogen-activated protein kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; MKP-6; MKP6MKP-Ldual specificity protein phosphatase 14 DUSP14 MKP-L, MKP6 dual specificity phosphatase 14 dual specificity protein phosphatase 14|MAP kinase phosphatase 6|MKP-1-like protein tyrosine phosphatase|MKP-6|mitogen-activated protein kinase phosphatase 6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DUSP14, check out the DUSP14 Infographic

DUSP14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DUSP14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95147

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DUSP14 (NM_007026) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DUSP14 (NM_007026) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DUSP14 (NM_007026) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95147
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.