ZNHIT3 (NM_004773) Human Recombinant Protein

ZNHIT3 protein,

Product Info Summary

SKU: PROTQ15649
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNHIT3 (NM_004773) Human Recombinant Protein

View all ZNHIT3 recombinant proteins

SKU/Catalog Number

PROTQ15649

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens zinc finger, HIT type 3 (ZNHIT3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNHIT3 (NM_004773) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15649)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.4 kDa

Amino Acid Sequence

MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES

Validation Images & Assay Conditions

Gene/Protein Information For ZNHIT3 (Source: Uniprot.org, NCBI)

Gene Name

ZNHIT3

Full Name

Zinc finger HIT domain-containing protein 3

Weight

17.4 kDa

Alternative Names

HNF-4a coactivator; Thyroid hormone receptor interactor 3TR-interacting protein 3; Thyroid receptor-interacting protein 3; TRIP-3; TRIP3thyroid receptor interacting protein 3; zinc finger HIT domain-containing protein 3; zinc finger, HIT domain containing 3; zinc finger, HIT type 3; zinc finger, HIT-type containing 3 ZNHIT3 Hit1, PEHO, TRIP3 zinc finger HIT-type containing 3 zinc finger HIT domain-containing protein 3|HNF-4a coactivator|TR-interacting protein 3|TRIP-3|thyroid hormone receptor interactor 3|thyroid receptor interacting protein 3|zinc finger, HIT domain containing 3|zinc finger, HIT type 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNHIT3, check out the ZNHIT3 Infographic

ZNHIT3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNHIT3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15649

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNHIT3 (NM_004773) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNHIT3 (NM_004773) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNHIT3 (NM_004773) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15649
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.