DEGS1 (NM_003676) Human Recombinant Protein

DEGS1 protein,

Recombinant protein of human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), transcript variant 1

Product Info Summary

SKU: PROTO15121
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DEGS1 (NM_003676) Human Recombinant Protein

View all DEGS1 recombinant proteins

SKU/Catalog Number

PROTO15121

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DEGS1 (NM_003676) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15121)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.7 kDa

Amino Acid Sequence

MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Validation Images & Assay Conditions

Gene/Protein Information For DEGS1 (Source: Uniprot.org, NCBI)

Gene Name

DEGS1

Full Name

Sphingolipid delta(4)-desaturase DES1

Weight

37.7 kDa

Superfamily

fatty acid desaturase type 1 family

Alternative Names

Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1, lipid desaturase (Drosophila); degenerative spermatocyte homolog, lipid desaturase (Drosophila); DEGS; Des-1; DES1degenerative spermatocyte homolog, lipid desaturase; EC 1.14; FADS7; membrane fatty acid (lipid) desaturase; Membrane lipid desaturase; MGC5079; migration-inducing gene 15 protein; MLDdihydroceramide desaturase; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase DES1 DEGS1 DEGS, DEGS-1, DES1, Des-1, FADS7, HLD18, MIG15, MLD delta 4-desaturase, sphingolipid 1 sphingolipid delta(4)-desaturase DES1|cell migration-inducing gene 15 protein|degenerative spermatocyte homolog 1, lipid desaturase|degenerative spermatocyte homolog, lipid desaturase|dihydroceramide desaturase 1|membrane fatty acid (lipid) desaturase|membrane lipid desaturase|migration-inducing gene 15 protein|sphingolipid delta 4 desaturase|sphingolipid delta(4)-desaturase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DEGS1, check out the DEGS1 Infographic

DEGS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DEGS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15121

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DEGS1 (NM_003676) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DEGS1 (NM_003676) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DEGS1 (NM_003676) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15121
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.