DAP1 (DAP) (NM_004394) Human Recombinant Protein

DAP1 protein,

Product Info Summary

SKU: PROTP51397
Size: 20 µg
Source: HEK293T

Product Name

DAP1 (DAP) (NM_004394) Human Recombinant Protein

View all DAP1 recombinant proteins

SKU/Catalog Number

PROTP51397

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human death-associated protein (DAP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DAP1 (DAP) (NM_004394) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51397)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11 kDa

Amino Acid Sequence

MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK

Validation Images & Assay Conditions

Gene/Protein Information For DAP (Source: Uniprot.org, NCBI)

Gene Name

DAP

Full Name

Death-associated protein 1

Weight

11 kDa

Alternative Names

DAP1; DAP-1; death-associated protein 1; death-associated protein; MGC99796 DAP death associated protein death-associated protein 1|DAP-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DAP, check out the DAP Infographic

DAP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DAP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51397

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DAP1 (DAP) (NM_004394) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DAP1 (DAP) (NM_004394) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DAP1 (DAP) (NM_004394) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51397
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.