CYP2C18 (NM_000772) Human Recombinant Protein

Cytochrome P450 2C18 protein,

Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1

Product Info Summary

SKU: PROTP33260
Size: 20 µg
Source: HEK293T

Product Name

CYP2C18 (NM_000772) Human Recombinant Protein

View all Cytochrome P450 2C18 recombinant proteins

SKU/Catalog Number

PROTP33260

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 18 (CYP2C18), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CYP2C18 (NM_000772) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP33260)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

55.5 kDa

Amino Acid Sequence

MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV

Validation Images & Assay Conditions

Gene/Protein Information For CYP2C18 (Source: Uniprot.org, NCBI)

Gene Name

CYP2C18

Full Name

Cytochrome P450 2C18

Weight

55.5 kDa

Superfamily

cytochrome P450 family

Alternative Names

(S)-mephenytoin hydroxylase associated cytochrome P450; CPCI; CYP2C; CYP2C17; CYPIIC18; cytochrome P450 2C18; cytochrome P450, family 2, subfamily C, polypeptide 18; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18; Cytochrome P450-6b/29c; DKFZp686I24235; EC 1.14.14.1; flavoprotein-linked monooxygenase; microsomal monooxygenase; P450-6B/29C; P450IIC17; unspecific monooxygenase CYP2C18 CPCI, CYP2C, CYP2C17, P450-6B/29C, P450IIC17 cytochrome P450 family 2 subfamily C member 18 cytochrome P450 2C18|(S)-mephenytoin hydroxylase associated cytochrome P450|CYPIIC18|cytochrome P450, family 2, subfamily C, polypeptide 18|cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17|cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18|cytochrome P450-6B/29C|flavoprotein-linked monooxygenase|microsomal monooxygenase|unspecific monooxygenase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CYP2C18, check out the CYP2C18 Infographic

CYP2C18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CYP2C18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP33260

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CYP2C18 (NM_000772) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CYP2C18 (NM_000772) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CYP2C18 (NM_000772) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP33260
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.