Cyclin D2 (CCND2) (NM_001759) Human Recombinant Protein

Cyclin D2 protein,

Product Info Summary

SKU: PROTP30279
Size: 20 µg
Source: HEK293T

Product Name

Cyclin D2 (CCND2) (NM_001759) Human Recombinant Protein

View all Cyclin D2 recombinant proteins

SKU/Catalog Number

PROTP30279

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cyclin D2 (CCND2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Cyclin D2 (CCND2) (NM_001759) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP30279)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.9 kDa

Amino Acid Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Validation Images & Assay Conditions

Gene/Protein Information For CCND2 (Source: Uniprot.org, NCBI)

Gene Name

CCND2

Full Name

G1/S-specific cyclin-D2

Weight

32.9 kDa

Superfamily

cyclin family

Alternative Names

CCND2; Cyclin D2; G1/S-specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; Vin1 CCND2 KIAK0002, MPPH3 cyclin D2 G1/S-specific cyclin-D2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCND2, check out the CCND2 Infographic

CCND2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCND2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP30279

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Cyclin D2 (CCND2) (NM_001759) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Cyclin D2 (CCND2) (NM_001759) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Cyclin D2 (CCND2) (NM_001759) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP30279
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.