CYB5R1 (NM_016243) Human Recombinant Protein

CYB5R1 protein,

Product Info Summary

SKU: PROTQ9UHQ9
Size: 20 µg
Source: HEK293T

Product Name

CYB5R1 (NM_016243) Human Recombinant Protein

View all CYB5R1 recombinant proteins

SKU/Catalog Number

PROTQ9UHQ9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cytochrome b5 reductase 1 (CYB5R1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CYB5R1 (NM_016243) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UHQ9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.9 kDa

Amino Acid Sequence

MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

Validation Images & Assay Conditions

Gene/Protein Information For CYB5R1 (Source: Uniprot.org, NCBI)

Gene Name

CYB5R1

Full Name

NADH-cytochrome b5 reductase 1

Weight

33.9 kDa

Superfamily

flavoprotein pyridine nucleotide cytochrome reductase family

Alternative Names

b5R.1; B5R1; CYB5BR1; cytochrome b5 reductase 1; EC 1.6.2.2; Humb5R2; NAD(P)H:quinone oxidoreductase type 3 polypeptide A2; NQO3A2polypeptide A2 CYB5R1 B5R.1, B5R1, B5R2, NQO3A2, humb5R2 cytochrome b5 reductase 1 NADH-cytochrome b5 reductase 1|NAD(P)H:quinone oxidoreductase type 3, polypeptide A2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CYB5R1, check out the CYB5R1 Infographic

CYB5R1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CYB5R1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UHQ9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CYB5R1 (NM_016243) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CYB5R1 (NM_016243) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CYB5R1 (NM_016243) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UHQ9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.