COX6B2 (NM_144613) Human Recombinant Protein

COX6B2 protein,

Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2)

Product Info Summary

SKU: PROTQ6YFQ2
Size: 20 µg
Source: HEK293T

Product Name

COX6B2 (NM_144613) Human Recombinant Protein

View all COX6B2 recombinant proteins

SKU/Catalog Number

PROTQ6YFQ2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COX6B2 (NM_144613) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6YFQ2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.3 kDa

Amino Acid Sequence

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI

Validation Images & Assay Conditions

Gene/Protein Information For COX6B2 (Source: Uniprot.org, NCBI)

Gene Name

COX6B2

Full Name

Cytochrome c oxidase subunit 6B2

Weight

10.3 kDa

Superfamily

cytochrome c oxidase subunit 6B family

Alternative Names

Cancer/testis antigen 59; COX VIb-2; COXVIB2; CT59MGC119094; cytochrome c oxidase subunit 6B2; Cytochrome c oxidase subunit VIb isoform 2; cytochrome c oxidase subunit VIb polypeptide 2 (testis); cytochrome c oxidase subunit VIb, testes specific; cytochrome c oxidase subunit VIb, testes-specific; Cytochrome c oxidase subunit VIb, testis-specific isoform; FLJ32865; FLJ46422 COX6B2 COXVIB2, CT59 cytochrome c oxidase subunit 6B2 cytochrome c oxidase subunit 6B2|COX VIb-2|cancer/testis antigen 59|cytochrome c oxidase subunit VIb polypeptide 2 (testis)|cytochrome c oxidase subunit VIb, testes-specific

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COX6B2, check out the COX6B2 Infographic

COX6B2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COX6B2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6YFQ2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COX6B2 (NM_144613) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COX6B2 (NM_144613) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COX6B2 (NM_144613) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6YFQ2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.