COX16 (NM_016468) Human Recombinant Protein

COX16 protein,

Recombinant protein of human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16)

Product Info Summary

SKU: PROTQ9P0S2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COX16 (NM_016468) Human Recombinant Protein

View all COX16 recombinant proteins

SKU/Catalog Number

PROTQ9P0S2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COX16 (NM_016468) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9P0S2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.1 kDa

Amino Acid Sequence

MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

Validation Images & Assay Conditions

Gene/Protein Information For COX16 (Source: Uniprot.org, NCBI)

Gene Name

COX16

Full Name

Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial

Weight

12.1 kDa

Superfamily

COX16 family

Alternative Names

C14orf112; chromosome 14 open reading frame 112; COX16 cytochrome c oxidase assembly homolog (S. cerevisiae); cytochrome c oxidase assembly factor; cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; HSPC203 COX16 C14orf112, HSPC203, hCOX16 cytochrome c oxidase assembly factor COX16 cytochrome c oxidase assembly protein COX16 homolog, mitochondrial|COX16, cytochrome c oxidase assembly homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COX16, check out the COX16 Infographic

COX16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COX16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9P0S2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COX16 (NM_016468) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COX16 (NM_016468) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COX16 (NM_016468) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9P0S2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.