Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Recombinant Protein

Bhlha9 protein,

Purified recombinant protein of Homo sapiens basic helix-loop-helix family, member a9 (BHLHA9).

Product Info Summary

SKU: PROTQ7RTU4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Recombinant Protein

View all Bhlha9 recombinant proteins

SKU/Catalog Number

PROTQ7RTU4

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens basic helix-loop-helix family, member a9 (BHLHA9).

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7RTU4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24 kDa

Amino Acid Sequence

MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHGPAARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCPPHAPLARPSAVAEGPGLAQASGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS

Validation Images & Assay Conditions

Gene/Protein Information For BHLHA9 (Source: Uniprot.org, NCBI)

Gene Name

BHLHA9

Full Name

Class A basic helix-loop-helix protein 9

Weight

24 kDa

Alternative Names

Basic Helix-Loop-Helix Family, Member A9; bHLHa9; BHLHF42; Class A Basic Helix-Loop-Helix Protein 9; Class F Basic Helix-Loop-Helix Factor 42; Class II Basic Helix-Loop-Helix Protein Bhlha9|A830053O21Rik, Fin, Fingerin|basic helix-loop-helix family, member a9|class A basic helix-loop-helix protein 9|bHLHf42|class B basic helix-loop-helix factor 42|novel helix-loop-helix DNA-binding domain containing protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BHLHA9, check out the BHLHA9 Infographic

BHLHA9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BHLHA9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7RTU4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7RTU4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.