Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

Centrin 1 protein,

Product Info Summary

SKU: PROTQ12798
Size: 20 µg
Source: HEK293T

Product Name

Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

View all Centrin 1 recombinant proteins

SKU/Catalog Number

PROTQ12798

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human centrin, EF-hand protein, 1 (CETN1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ12798)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.4 kDa

Amino Acid Sequence

MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

Validation Images & Assay Conditions

Gene/Protein Information For CETN1 (Source: Uniprot.org, NCBI)

Gene Name

CETN1

Full Name

Centrin-1

Weight

19.4 kDa

Superfamily

centrin family

Alternative Names

calcium binding protein; Caltractin isoform 2; caltractin; CEN1centrin-1; centrin, EF-hand protein, 1; CETN; EF-hand protein CETN1 CEN1, CETN centrin 1 centrin-1|EF-hand protein|calcium binding protein|caltractin|centrin, EF-hand protein, 1|testicular tissue protein Li 37

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CETN1, check out the CETN1 Infographic

CETN1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CETN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ12798

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ12798
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.