CDC42SE1 (NM_020239) Human Recombinant Protein

CDC42SE1 protein,

Recombinant protein of human CDC42 small effector 1 (CDC42SE1), transcript variant 2

Product Info Summary

SKU: PROTQ9NRR8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CDC42SE1 (NM_020239) Human Recombinant Protein

View all CDC42SE1 recombinant proteins

SKU/Catalog Number

PROTQ9NRR8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CDC42 small effector 1 (CDC42SE1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDC42SE1 (NM_020239) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NRR8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.7 kDa

Amino Acid Sequence

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

Validation Images & Assay Conditions

Gene/Protein Information For CDC42SE1 (Source: Uniprot.org, NCBI)

Gene Name

CDC42SE1

Full Name

CDC42 small effector protein 1

Weight

8.7 kDa

Superfamily

CDC42SE/SPEC family

Alternative Names

1300002M12Rik; CDC42 small effector 1; CDC42-binding protein SCIP1; SCIP1; signaling molecule SPEC1 beta; Small effector of CDC42 protein 1; small protein effector 1 of Cdc42; SPEC1CDC42 small effector protein 1 CDC42SE1 SCIP1, SPEC1 CDC42 small effector 1 CDC42 small effector protein 1|1300002M12Rik|CDC42-binding protein SCIP1|signaling molecule SPEC1 beta|small effector of CDC42 protein 1|small protein effector 1 of Cdc42

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDC42SE1, check out the CDC42SE1 Infographic

CDC42SE1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDC42SE1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NRR8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDC42SE1 (NM_020239) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDC42SE1 (NM_020239) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDC42SE1 (NM_020239) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NRR8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.