CDC42 (NM_001791) Human Recombinant Protein

CDC42 protein,

Product Info Summary

SKU: PROTP60953
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CDC42 (NM_001791) Human Recombinant Protein

View all CDC42 recombinant proteins

SKU/Catalog Number

PROTP60953

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDC42 (NM_001791) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60953)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.1 kDa

Amino Acid Sequence

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Validation Images & Assay Conditions

Gene/Protein Information For CDC42 (Source: Uniprot.org, NCBI)

Gene Name

CDC42

Full Name

Cell division control protein 42 homolog

Weight

21.1 kDa

Superfamily

small GTPase superfamily

Alternative Names

CDC42; CDC42Hs; cell division control protein 42 homolog; cell division cycle 42 (GTP binding protein, 25kDa); cell division cycle 42 (GTP-binding protein, 25kD); dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)); G25K GTP-binding protein; G25K; growth-regulating protein; GTP-binding protein, 25kD; small GTP binding protein CDC42 CDC42 CDC42Hs, G25K, TKS cell division cycle 42 cell division control protein 42 homolog|G25K GTP-binding protein|GTP binding protein, 25kDa|dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))|dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))|growth-regulating protein|small GTP binding protein CDC42

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDC42, check out the CDC42 Infographic

CDC42 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDC42: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60953

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDC42 (NM_001791) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDC42 (NM_001791) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDC42 (NM_001791) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60953
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product