CD72 (NM_001782) Human Recombinant Protein

Cd72 protein,

Product Info Summary

SKU: PROTP21854
Size: 20 µg
Source: HEK293T

Product Name

CD72 (NM_001782) Human Recombinant Protein

View all Cd72 recombinant proteins

SKU/Catalog Number

PROTP21854

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CD72 molecule (CD72)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD72 (NM_001782) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21854)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40 kDa

Amino Acid Sequence

MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

Validation Images & Assay Conditions

Gene/Protein Information For CD72 (Source: Uniprot.org, NCBI)

Gene Name

CD72

Full Name

B-cell differentiation antigen CD72

Weight

40 kDa

Alternative Names

CD72 antigenB-cell differentiation antigen CD72; CD72 molecule; CD72; CD72b; Ly-19.2; Ly-32.2; Lyb-2; LYB2lyb-2 CD72 CD72b, LYB2 CD72 molecule B-cell differentiation antigen CD72|CD72 antigen|lyb-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD72, check out the CD72 Infographic

CD72 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD72: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP21854

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD72 (NM_001782) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD72 (NM_001782) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD72 (NM_001782) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP21854
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.