Product Info Summary
SKU: | A03149 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, IHC-F, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD272/BTLA Antibody Picoband®
View all BTLA/CD272 Antibodies
SKU/Catalog Number
A03149
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CD272/BTLA Antibody Picoband® catalog # A03149. Tested in Flow Cytometry, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD272/BTLA Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03149)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human CD272/BTLA.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A03149 is reactive to BTLA in Human, Mouse
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
65 kDa
Calculated molecular weight
65411 MW
Background of BTLA/CD272
B- and T-lymphocyte attenuator is a protein that in humans is encoded by the BTLA gene. BTLA has also been designated as CD272 (cluster of differentiation 272). This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 and CTLA4, BTLA interacts with a B7 homolog, B7H4.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A03149 is guaranteed for Flow Cytometry, IHC, IHC-F, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: human HEK293 whole cell, human Jurkat whole cell, human CCRF-CEM whole cell, mouse thymus tissue
IHC: mouse spleen tissue, mouse spleen tissue, human tonsil tissue
FCM: THP-1 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CD272 using anti-CD272 antibody (A03149).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HEK293 whole cell lysate,
Lane 2: human Jurkat whole cell lysate,
Lane 3: human CCRF-CEM whole cell lysate,
Lane 4: mouse thymus tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD272 antigen affinity purified polyclonal antibody (Catalog # A03149) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CD272 at approximately 65KD. The expected band size for CD272 is at 33KD.
Click image to see more details
Figure 2. IHC analysis of CD272/BTLA using anti-CD272/BTLA antibody (A03149).
CD272/BTLA was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD272/BTLA Antibody (A03149) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of CD272/BTLA using anti-CD272/BTLA antibody (A03149).
CD272/BTLA was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD272/BTLA Antibody (A03149) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of CD272/BTLA using anti-CD272/BTLA antibody (A03149).
CD272/BTLA was detected in paraffin-embedded section of human tonsil tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD272/BTLA Antibody (A03149) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. Flow Cytometry analysis of THP-1 cells using anti-CD272/BTLA antibody (A03149).
Overlay histogram showing THP-1 cells stained with A03149 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-CD272/BTLA Antibody (A03149,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For BTLA (Source: Uniprot.org, NCBI)
Gene Name
BTLA
Full Name
B- and T-lymphocyte attenuator
Weight
65411 MW
Alternative Names
B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; CD272; BTLA BTLA BTLA1, CD272 B and T lymphocyte associated B- and T-lymphocyte attenuator|B- and T-lymphocyte-associated protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on BTLA, check out the BTLA Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BTLA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CD272/BTLA Antibody Picoband® (A03149)
Hello CJ!
No publications found for A03149
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD272/BTLA Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CD272/BTLA Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-CD272/BTLA Antibody Picoband®
Question
Our lab were content with the WB result of your anti-CD272/BTLA antibody . However we have seen positive staining in trachea cell membrane using this antibody. Is that expected? Could you tell me where is BTLA supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-04-02
Answer
Based on literature, trachea does express BTLA. Generally BTLA expresses in cell membrane. Regarding which tissues have BTLA expression, here are a few articles citing expression in various tissues:
Peripheral blood, Pubmed ID: 16641997
Trachea, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-04-02
Question
Is this A03149 anti-CD272/BTLA antibody reactive to the isotypes of BTLA?
Verified Customer
Verified customer
Asked: 2020-04-01
Answer
The immunogen of A03149 anti-CD272/BTLA antibody is A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-01
Question
I was wanting to use your anti-CD272/BTLA antibody for IHC-F for mouse peripheral blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse peripheral blood identification?
Verified Customer
Verified customer
Asked: 2020-02-14
Answer
As indicated on the product datasheet, A03149 anti-CD272/BTLA antibody has been tested for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse peripheral blood in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-14
Question
See attached the WB image, lot number and protocol we used for peripheral blood using anti-CD272/BTLA antibody A03149. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-01-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-28
Question
We have observed staining in human leukocyte. Any tips? Is anti-CD272/BTLA antibody supposed to stain leukocyte positively?
Verified Customer
Verified customer
Asked: 2019-12-12
Answer
Based on literature leukocyte does express BTLA. Based on Uniprot.org, BTLA is expressed in leukocyte, peripheral blood, trachea, among other tissues. Regarding which tissues have BTLA expression, here are a few articles citing expression in various tissues:
Peripheral blood, Pubmed ID: 16641997
Trachea, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-12-12
Question
Our lab used your anti-CD272/BTLA antibody for WB on trachea in a previous project. I am using mouse, and We are going to use the antibody for ICC next. Our lab want to know about examining trachea as well as leukocyte in our next experiment. Could you please give me some suggestion on which antibody would work the best for ICC?
Verified Customer
Verified customer
Asked: 2019-12-03
Answer
I have checked the website and datasheets of our anti-CD272/BTLA antibody and I see that A03149 has been tested on mouse in both WB and ICC. Thus A03149 should work for your application. Our Boster satisfaction guarantee will cover this product for ICC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for ICC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-12-03
Question
We are currently using anti-CD272/BTLA antibody A03149 for mouse tissue, and we are content with the IHC-F results. The species of reactivity given in the datasheet says human, mouse. Is it likely that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-11-18
Answer
The anti-CD272/BTLA antibody (A03149) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-11-18
Question
We need using your anti-CD272/BTLA antibody for immune response-regulating cell surface receptor signaling pathway studies. Has this antibody been tested with western blotting on human hek293 whole cell lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-11-15
Answer
We appreciate your inquiry. This A03149 anti-CD272/BTLA antibody is validated on human hek293 whole cell lysate, jurkat whole cell lysate, mouse thymus tissue, tissue lysate. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, ICC, WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-11-15
Question
Do you have a BSA free version of anti-CD272/BTLA antibody A03149 available?
Verified Customer
Verified customer
Asked: 2019-10-31
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-CD272/BTLA antibody A03149 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-10-31
Question
Does A03149 anti-CD272/BTLA antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-09-20
Answer
It shows on the product datasheet, A03149 anti-CD272/BTLA antibody as been validated on IHC-F. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-09-20
Question
I see that the anti-CD272/BTLA antibody A03149 works with IHC-F, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-08-13
Answer
You can find protocols for IHC-F on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-08-13
Question
Is a blocking peptide available for product anti-CD272/BTLA antibody (A03149)?
Verified Customer
Verified customer
Asked: 2019-07-15
Answer
We do provide the blocking peptide for product anti-CD272/BTLA antibody (A03149). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-07-15
Question
Does anti-CD272/BTLA antibody A03149 work for IHC-F with peripheral blood?
Verified Customer
Verified customer
Asked: 2018-12-19
Answer
According to the expression profile of peripheral blood, BTLA is highly expressed in peripheral blood. So, it is likely that anti-CD272/BTLA antibody A03149 will work for IHC-F with peripheral blood.
Boster Scientific Support
Answered: 2018-12-19
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for peripheral blood using anti-CD272/BTLA antibody A03149. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-08-06
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-08-06
Question
Can you help my question with product A03149, anti-CD272/BTLA antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2017-11-10
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03149 anti-CD272/BTLA antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-11-10
Question
I am interested in to test anti-CD272/BTLA antibody A03149 on mouse peripheral blood for research purposes, then I may be interested in using anti-CD272/BTLA antibody A03149 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
C. Zhang
Verified customer
Asked: 2015-11-10
Answer
The products we sell, including anti-CD272/BTLA antibody A03149, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-11-10