CD153 (TNFSF8) (NM_001244) Human Recombinant Protein

CD30 Ligand/TNFSF8 protein,

Product Info Summary

SKU: PROTP32971
Size: 20 µg
Source: HEK293T

Product Name

CD153 (TNFSF8) (NM_001244) Human Recombinant Protein

View all CD30 Ligand/TNFSF8 recombinant proteins

SKU/Catalog Number

PROTP32971

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD153 (TNFSF8) (NM_001244) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP32971)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.8 kDa

Amino Acid Sequence

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Validation Images & Assay Conditions

Gene/Protein Information For TNFSF8 (Source: Uniprot.org, NCBI)

Gene Name

TNFSF8

Full Name

Tumor necrosis factor ligand superfamily member 8

Weight

25.8 kDa

Superfamily

tumor necrosis factor family

Alternative Names

CD153 antigen; CD153; CD30 antigen ligand; CD30 Ligand; CD30L; CD30-L; CD30LCD30 ligand; CD30LGMGC138144; TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand superfamily member 8 TNFSF8 CD153, CD30L, CD30LG, TNLG3A TNF superfamily member 8 tumor necrosis factor ligand superfamily member 8|CD153 antigen|CD30 antigen ligand|CD30 ligand|CD30-L|tumor necrosis factor (ligand) superfamily, member 8|tumor necrosis factor ligand 3A|tumor necrosis factor superfamily member 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFSF8, check out the TNFSF8 Infographic

TNFSF8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFSF8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP32971

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD153 (TNFSF8) (NM_001244) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD153 (TNFSF8) (NM_001244) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD153 (TNFSF8) (NM_001244) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP32971
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.