Product Info Summary
SKU: | PROTO15467 |
---|---|
Size: | 5ug, 20ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
CCL16 LEC/NCC-4 Human Recombinant Protein
View all CCL16/HCC-4/LEC recombinant proteins
SKU/Catalog Number
PROTO15467
Size
5ug, 20ug, 1mg
Description
CCL16 Human Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL16 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Cite This Product
CCL16 LEC/NCC-4 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15467)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The CCL16 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Purity
Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
13.6kDa
Reconstitution
It is recommended to reconstitute the lyophilized CCL16in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Biological Activity
Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized CCL16in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For CCL16 (Source: Uniprot.org, NCBI)
Gene Name
CCL16
Full Name
C-C motif chemokine 16
Weight
13.6kDa
Superfamily
intercrine beta (chemokine CC) family
Alternative Names
C-C motif chemokine 16; Small-inducible cytokine A16; IL-10-inducible chemokine; Chemokine LEC; Monotactin-1; Chemokine CC-4; Lymphocyte and monocyte chemoattractant; CCL-16; HCC-4; HCC4; NCC4; NCC-4; Liver Expressed Chemokine; LMC; LCC-1; LCC1; MTN-1; MTN1; SCYL4; ckB12; SCYA16; LEC; ILINCK; MGC117051 CCL16 CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4 C-C motif chemokine ligand 16 C-C motif chemokine 16|IL-10-inducible chemokine|chemokine (C-C motif) ligand 16|chemokine LEC|liver CC chemokine-1|liver-expressed chemokine|lymphocyte and monocyte chemoattractant|monotactin-1|new CC chemokine 4|small inducible cytokine subfamily A (Cys-Cys), member 16|small-inducible cytokine A16
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CCL16, check out the CCL16 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCL16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For CCL16 LEC/NCC-4 Human Recombinant Protein (PROTO15467)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used CCL16 LEC/NCC-4 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For CCL16 LEC/NCC-4 Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question