CCL16 LEC/NCC-4 Human Recombinant Protein

CCL16/HCC-4/LEC protein, Human

CCL16 Human Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTO15467
Size: 5ug, 20ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

CCL16 LEC/NCC-4 Human Recombinant Protein

View all CCL16/HCC-4/LEC recombinant proteins

SKU/Catalog Number

PROTO15467

Size

5ug, 20ug, 1mg

Description

CCL16 Human Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL16 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

CCL16 LEC/NCC-4 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15467)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The CCL16 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Purity

Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Predicted MW

13.6kDa

Reconstitution

It is recommended to reconstitute the lyophilized CCL16in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Biological Activity

Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Reconstitution

It is recommended to reconstitute the lyophilized CCL16in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For CCL16 (Source: Uniprot.org, NCBI)

Gene Name

CCL16

Full Name

C-C motif chemokine 16

Weight

13.6kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

C-C motif chemokine 16; Small-inducible cytokine A16; IL-10-inducible chemokine; Chemokine LEC; Monotactin-1; Chemokine CC-4; Lymphocyte and monocyte chemoattractant; CCL-16; HCC-4; HCC4; NCC4; NCC-4; Liver Expressed Chemokine; LMC; LCC-1; LCC1; MTN-1; MTN1; SCYL4; ckB12; SCYA16; LEC; ILINCK; MGC117051 CCL16 CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4 C-C motif chemokine ligand 16 C-C motif chemokine 16|IL-10-inducible chemokine|chemokine (C-C motif) ligand 16|chemokine LEC|liver CC chemokine-1|liver-expressed chemokine|lymphocyte and monocyte chemoattractant|monotactin-1|new CC chemokine 4|small inducible cytokine subfamily A (Cys-Cys), member 16|small-inducible cytokine A16

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL16, check out the CCL16 Infographic

CCL16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15467

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCL16 LEC/NCC-4 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCL16 LEC/NCC-4 Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCL16 LEC/NCC-4 Human Recombinant Protein

Size

Total: $250

SKU:PROTO15467

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTO15467
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.